NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187846_10011971

Scaffold Ga0187846_10011971


Overview

Basic Information
Taxon OID3300021476 Open in IMG/M
Scaffold IDGa0187846_10011971 Open in IMG/M
Source Dataset NameBiofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4154
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm → Microbial Communities From Various Locations To Find New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameBrazil: State of Minas Gerais
CoordinatesLat. (o)-19.8881Long. (o)-43.6761Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000931Metagenome / Metatranscriptome829Y
F001908Metagenome / Metatranscriptome619Y
F099610Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0187846_100119714F099610GAGGMRTHPHSEATYRVVPLAGGAFGVEVVIPDTYPTTVSSFTTEAAAEAWIAREKARVQSETLAGRWFQKTRQGGGE
Ga0187846_100119715F000931AGGMSALDEITKEKRRLREALARVDAQRDQLTGQLGELEATERVLARYGKSMQARTTVSATTPTTAAAPERPRGRPRTATETPVDGKRTSLTLSDQVLALATA
Ga0187846_100119716F001908N/AMTQQEITAACKGARPNHVGVVISRHKRAGRIEQRDGKLYAKQSTGTEQGAAVAKRHSARGSR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.