Basic Information | |
---|---|
Taxon OID | 3300021476 Open in IMG/M |
Scaffold ID | Ga0187846_10198809 Open in IMG/M |
Source Dataset Name | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 840 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm → Microbial Communities From Various Locations To Find New Lineages Of Life (Nelli) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Brazil: State of Minas Gerais | |||||||
Coordinates | Lat. (o) | -19.8881 | Long. (o) | -43.6761 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F008706 | Metagenome / Metatranscriptome | 329 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0187846_101988092 | F008706 | GGAGG | MMHLHYGLLADILVELAKSLTSRPELDEQHRTELNEAAKQLCKSLEPHSKI |
⦗Top⦘ |