Scaffold Ga0187846_10460356

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0187846_10460356

Scaffold Ga0187846_10460356

Overview

Basic Information
Taxon OID	3300021476 Open in IMG/M
Scaffold ID	Ga0187846_10460356 Open in IMG/M
Source Dataset Name	Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	521
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm → Microbial Communities From Various Locations To Find New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location Name	Brazil: State of Minas Gerais
Coordinates	Lat. (^o)	-19.8881	Long. (^o)	-43.6761	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013201	Metagenome / Metatranscriptome	273	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187846_104603561	F013201	GGAG	MAWFYEIRSPNDTVLKRDGGFVNQDAAKLAARADAKKLRAAPESKRPEIGRILVGQNADKPTQY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.