NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210410_10000065

Scaffold Ga0210410_10000065


Overview

Basic Information
Taxon OID3300021479 Open in IMG/M
Scaffold IDGa0210410_10000065 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)177282
Total Scaffold Genes147 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)124 (84.35%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000165Metagenome / Metatranscriptome1824Y
F017173Metagenome / Metatranscriptome242Y
F028827Metagenome / Metatranscriptome190Y
F046939Metagenome / Metatranscriptome150Y

Sequences

Protein IDFamilyRBSSequence
Ga0210410_10000065118F028827AGGMEPVDLAYMREFIEECSRKALDVALHSESLTNLQRGRLLDILLWAGELFLLVRAPRLSLTGSLASPDPKLAATAAASRS
Ga0210410_10000065125F017173GGAGGMATPTNAIFVPKPAPGSYNKNRPAGKLLQAQTLHLREALLKHLEELAAVLAIDPRSLKTEGDVSAYIHRATAILHTRARPPRK
Ga0210410_10000065140F000165GGAGMMTTVPKQPPVVEDLRNHSQEQIAELRQLLALGAPSRPDPRRPGFYEVQGLANTYYVFKYPSGAKVLLLGVWERDPVAEMVACTCTAA
Ga0210410_1000006596F046939N/AMTDKWGRRLFKAGAVALLLVGLVHSLSLLRDPVPANDTEKQLLGLMSSYKFNLLGSVRTMAGMLRGFSVSFMLAALGFGVFDMVLSRERAGLLKRAALINIIWLAAMTAISLHYFFIVPTSFLGTTLLIFVLAWLKLPAEGTT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.