NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190333_1012151

Scaffold Ga0190333_1012151


Overview

Basic Information
Taxon OID3300021482 Open in IMG/M
Scaffold IDGa0190333_1012151 Open in IMG/M
Source Dataset NameHydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-04-6-7_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1380
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameMexico: Guaymas Basin
CoordinatesLat. (o)27.0114Long. (o)-110.5956Alt. (m)Depth (m)2011
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F093027Metagenome106N

Sequences

Protein IDFamilyRBSSequence
Ga0190333_10121511F093027N/AMAGNNLREIVKKQSPTIINTRKEEEMKIGILSILIALVLCIGTVSAFSSIDYSIQASDAVVSVNMKYSNILENETILGSQVVTLDHMDVTSAGMIVGDDTGVVLNNTLRAVPVRNCLISSGMINQNFASAVRTNESYDLGVTGFRADGRMIDLASDVQVELGALSHAARGQVAGSVGMGLITQTPTNRFESVVRSRSALQNVMMNANWQMPQPAVEIEVPSSDISSLCVWATQSSYPVFPISA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.