NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190305_1005095

Scaffold Ga0190305_1005095


Overview

Basic Information
Taxon OID3300021488 Open in IMG/M
Scaffold IDGa0190305_1005095 Open in IMG/M
Source Dataset NameHydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-07-2-3_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2605
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (44.44%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameMexico: Guaymas Basin
CoordinatesLat. (o)27.0114Long. (o)-110.5931Alt. (m)Depth (m)1999
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038026Metagenome166Y
F059532Metagenome133N

Sequences

Protein IDFamilyRBSSequence
Ga0190305_10050951F059532N/ALLLQEKLPDYEAVFLLGDITHGLGSKDFGKDVIDCDLHDQLQCAIKLLKPVTKGKKVVVITGSRYHSSIDYDIDRGLAEVLHAKFGGAISNIRLKGTDVVINIAHGIGSRPVYTGTRMNQDVFNAILTEHLLKMPEVSVIIRAHFHIFSYFAIYGKHFIYIPGWNAIRKGRFVTRWYFRQPDIGAVLLSIDNDNNVYVKPYLFKLKSERKNIYVL
Ga0190305_10050959F038026GAGGMLKFMIDKNEDEYILIIEYEDRAERLLASSLKDLIQIMADTTLYNFEGKSKYFEQSYHAKIEIT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.