NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190309_1034773

Scaffold Ga0190309_1034773


Overview

Basic Information
Taxon OID3300021498 Open in IMG/M
Scaffold IDGa0190309_1034773 Open in IMG/M
Source Dataset NameHydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-07-6-7_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)932
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Altiarchaeota → Candidatus Altiarchaeales → unclassified Candidatus Altiarchaeales → Candidatus Altiarchaeales archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameMexico: Guaymas Basin
CoordinatesLat. (o)27.0114Long. (o)-110.5931Alt. (m)Depth (m)1999
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055334Metagenome138N
F076704Metagenome117N

Sequences

Protein IDFamilyRBSSequence
Ga0190309_10347731F055334N/ALSGYKVMHFLRFPTASDYFPICLIVPIRITPLYRGGLLEDDEYSIIELEIHLITKVPYDYRGERLLKDLDAVMEKLRTLRHDESKWYELDYKGGVDLEYAPVEKWILQSAVIHVKVEA
Ga0190309_10347732F076704AGGAGGMPEYGAIKGWKNRIRIGLESCSNESIWHDGRNPLLNTFTMDTSVDIDKVFVIGSRDAVSMIEGVQEVTGTLERNLYSKNATYNEIIYAGNNSHLDLLTATGMYGEGLQSCKILMNTTSSSDSADYNRVIYGVKFHSYRTS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.