NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194048_10050291

Scaffold Ga0194048_10050291


Overview

Basic Information
Taxon OID3300021519 Open in IMG/M
Scaffold IDGa0194048_10050291 Open in IMG/M
Source Dataset NameAnoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1685
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada

Source Dataset Sampling Location
Location NameCanada: Ontario
CoordinatesLat. (o)49.697Long. (o)-93.722Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015732Metagenome / Metatranscriptome252N
F022415Metagenome / Metatranscriptome214Y
F046380Metagenome / Metatranscriptome151N

Sequences

Protein IDFamilyRBSSequence
Ga0194048_100502913F015732AGGAMTKVTNLETAVSIVRTSTDKATALADIMNILGVSRSNAFVYHTKASKILFSANNVDEIMGKVSPQYKKVSESVQGTSGTKKAQKLAEIDKFLAGNASAKGNPFAALGA
Ga0194048_100502915F046380GGAGGMNWKTLDQSFETMTQAEALEIVQQEATDMGLGLLETMTWMSDNYDELDSVQKNAFRTAFRGFQRLLAPVTE
Ga0194048_100502916F022415AGGAGMSRMSNLHMIITDAIACDLSEDLIIDLMVEEGLPREACPEILRVFKQVEAV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.