NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224700_173078

Scaffold Ga0224700_173078


Overview

Basic Information
Taxon OID3300021542 Open in IMG/M
Scaffold IDGa0224700_173078 Open in IMG/M
Source Dataset NameMarine sponge Cinachyra sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', cg17ic 200bp no Eukaryotes last
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of New South Wales
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)44959
Total Scaffold Genes57 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)23 (40.35%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Cinachyra Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location NameUpa-Upasina 'control' site, Papua New Guinea
CoordinatesLat. (o)-9.828217Long. (o)150.820517Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017577Metagenome / Metatranscriptome240Y
F065740Metagenome / Metatranscriptome127N

Sequences

Protein IDFamilyRBSSequence
Ga0224700_17307825F017577N/AMFPTSSLVSQSGVTTRRQWGSRPSRATLELEFSNITDANASALLSAYHSAEGSFDSLTLPDIVFNGTDATLKTWLSGSATGAGLVWSFTEGSPPTVNSVARGIHEVSISLTAELR
Ga0224700_17307828F065740AGAAGGMFKFVNYIHLLTTTYRYQNYSVNQTRTYSGNDYSFLPFGVSTGAGTKGGDRSSTRLVVGLNQISVNIFAEAVQSQWQLDLKTVSLDVTDDSDDALIRSEVWRIASYSIDTTRLILTLSSPLDAAASDVPRRLLTTELVGALPTNG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.