NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126371_10000166

Scaffold Ga0126371_10000166


Overview

Basic Information
Taxon OID3300021560 Open in IMG/M
Scaffold IDGa0126371_10000166 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama - MetaG Plot_4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)50391
Total Scaffold Genes56 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)44 (78.57%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000260Metagenome / Metatranscriptome1431Y
F000978Metagenome / Metatranscriptome815Y
F011701Metagenome / Metatranscriptome288Y
F013561Metagenome / Metatranscriptome270Y

Sequences

Protein IDFamilyRBSSequence
Ga0126371_1000016638F000978AGGAGVRPLCCLRCRREIEAGNKSVAVYMFAQTVGVRPRQKSTAQRICFCPQCAVSLAMGLPPDGALNMVAWDMIRELVSAEPSLNEAAWEGLRGVIGLLPSGNDGEAAPGYRRAG
Ga0126371_1000016645F013561GAGMSDNQVDLIHSFQAFIRAAEQGATIPTVDENDLKVLHELAVDRAKRYCGKDGVISIELTARACSPTANVPAVWLRHTQLRSIFREGRLAEWQRGTMLDQTVFRVAATLPMQGTKLDHDVFIQNLRAATSTSAINH
Ga0126371_1000016651F011701AGGAGGMQSRQSRAWLVCTLLTTLLLVAGAARANSGREFSGYFDISHVQEQGDLVQVTLHLKLFNHSESDARSVIVTLLDSSPAMTLRGNFQPVKVWKSHQFLEMSQEFTVTKREFKEWMTPPAQPNLVILFQDRKGATWQRGAQISRRPLVATQD
Ga0126371_1000016655F000260GAGGMNWKRLALGIFTALAMLALTYLLPRGGTLREASLVQFPMTVGVWAIFVLLFVKLK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.