NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190354_1004088

Scaffold Ga0190354_1004088


Overview

Basic Information
Taxon OID3300021590 Open in IMG/M
Scaffold IDGa0190354_1004088 Open in IMG/M
Source Dataset NameHydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-13-12-13_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2493
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameMexico: Guaymas Basin
CoordinatesLat. (o)27.0114Long. (o)-110.5956Alt. (m)Depth (m)2011
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F102257Metagenome101N

Sequences

Protein IDFamilyRBSSequence
Ga0190354_10040883F102257GAGGMGYYVSNIIGIRTGGVFSGEKDVDNIKKRIKKIVLEMREESKKKRGEVFEPDLGWQDGDPSHCMCDKELVGSKGSYVVLAGVFNYWTFNKAEQFAKRLSEEFGTHVMLMSWDEEQDIIKSDIYLGGKPIREINEDPISSALRRIV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.