NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194060_10098412

Scaffold Ga0194060_10098412


Overview

Basic Information
Taxon OID3300021602 Open in IMG/M
Scaffold IDGa0194060_10098412 Open in IMG/M
Source Dataset NameAnoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1614
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada

Source Dataset Sampling Location
Location NameCanada: Ontario
CoordinatesLat. (o)49.697Long. (o)-93.722Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000311Metagenome / Metatranscriptome1326Y
F000980Metagenome / Metatranscriptome814Y
F001043Metagenome / Metatranscriptome794Y
F001125Metagenome / Metatranscriptome769Y

Sequences

Protein IDFamilyRBSSequence
Ga0194060_100984121F000980N/AQLTCPCNSKCTLVSVEDATIPYTDTPLQTKEETMEETTTPAATVPDTYNANLLVTYKVIRGYSDAEYATDKVASLEWDLHNGRESQKRVSLYLSKIDAVKEIICEAYVDSQDQDTLRAIAEALSIELTRTVEWSATIEVSGSIDIDILEDVDFEQEIYDNLYVDSQNGQIEIGDTEVTNVREC
Ga0194060_100984122F000311AGGMEMAYWDAQIIGLDPHALSPLTFNIGTGSIEKVSKIRDKYNLIESYTSDYEPTGYTGR
Ga0194060_100984123F001043N/AMSQQDTQGDNMSDYKDGFDDGYKFAREEIMEKLAEIDIADIDSWILDRLSEMIEGGNL
Ga0194060_100984125F001125AGGCGGMGDRANFGFKQSNENTIFLYGHWAGHGMLERLANAVEAARPRWTDESYATRICVSQIVGEDWTQETGWGLSVNRILDNEHKIPVIDWAEQTFTLMEEDLQTVVFSLSLDKFCTKYSQLVV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.