Scaffold Ga0210304_1068120

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0210304_1068120

Scaffold Ga0210304_1068120

Overview

Basic Information
Taxon OID	3300021849 Open in IMG/M
Scaffold ID	Ga0210304_1068120 Open in IMG/M
Source Dataset Name	Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	634
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location Name	USA: Oregon
Coordinates	Lat. (^o)	46.183	Long. (^o)	-123.18	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021521	Metagenome / Metatranscriptome	218	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0210304_10681201	F021521	GGA	MAGYSHRTAQPLILAVFLPWGGSAGAGRVRPAGAKVRFALNS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.