NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187838_1064596

Scaffold Ga0187838_1064596


Overview

Basic Information
Taxon OID3300021851 Open in IMG/M
Scaffold IDGa0187838_1064596 Open in IMG/M
Source Dataset NameMetatranscriptome of extremophilic microbial mat communities from Yellowstone National Park, Wyoming, USA - CONBC_RNA (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)657
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5564Long. (o)-110.8321Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005746Metatranscriptome391N

Sequences

Protein IDFamilyRBSSequence
Ga0187838_10645961F005746N/AGFEWAKARVSSLVQWLLKIRAGESPRKPDWWHDRYLHYAYRVAQSGSTSKFLQLIQVWRVALTAYGRLKTHPTPEDVEKFERAVETALTLTVELPSGRVVEVDTEDWRSRFPWRAYFGFTPRDVLPEVRIQREIQPLNPLSLKILDRRGRYTPVGEELMRDAWWVMQDHILHPPGSVPAYWPMLPVLPDFRPEPGSVRAHGNVFCRVQPDGKARFYYA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.