Scaffold Ga0187838_1102377

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0187838_1102377

Scaffold Ga0187838_1102377

Overview

Basic Information
Taxon OID	3300021851 Open in IMG/M
Scaffold ID	Ga0187838_1102377 Open in IMG/M
Source Dataset Name	Metatranscriptome of extremophilic microbial mat communities from Yellowstone National Park, Wyoming, USA - CONBC_RNA (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1652
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Thermoproteus → unclassified Thermoproteus → Thermoproteus sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location Name	USA: Wyoming
Coordinates	Lat. (^o)	44.5564	Long. (^o)	-110.8321	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100050	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187838_11023773	F100050	GGA	MDVIVRYMLATLLALVGGLVGFYLIPYEPFGAVGNVLFMGALFGFIAGFLGFTGFFGNVVNAFLVSFILWFVLPGQWFVIWTGGNAGYMVGNVLGQLGRLSAVKKIEAEAL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.