 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300021883 Open in IMG/M |
| Scaffold ID | Ga0063126_1003942 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S0 C1 B9 (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 798 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Patellogastropoda → Lottioidea → Lottiidae → Lottia → Lottia gigantea | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 28.999982 | Long. (o) | -14.999994 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001979 | Metatranscriptome | 608 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0063126_10039421 | F001979 | N/A | SPTMSVTLRPNLNFATKTDNTSVDWDELKGKLSSFQVDKLNYFFTQFFDHNQDGVIDAKDFSGLNERLRKVAGWDLDDPQYLAVCDNNRVFFECLLEQAYAERNTEGLEDRTWEQALAPSKMVVDSVSLNSWLHMWARMCQGAAGIDDFPIWVQLIPRVIFNVICSKEGGEIISRSSLRNFYENFTGLSGDTLEKVSTEGFRSMTANGDYELDYSSYKLLFSNFLLGRTIYGPGKYVFGCFDNSDMTEKYKIDYNG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |