Basic Information | |
---|---|
Taxon OID | 3300021884 Open in IMG/M |
Scaffold ID | Ga0063143_1001062 Open in IMG/M |
Source Dataset Name | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S25 C1 B22 (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1763 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 58.000163 | Long. (o) | -16.520083 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000371 | Metagenome / Metatranscriptome | 1220 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0063143_10010622 | F000371 | AGAAG | LLPQGDQVPQDAQDYKAELKRIQDYVIDLHKRVMATCDAFSEDVKYWAEYKTGIKGFKPWLAEAEKKSTEGLSKPQTLDEANAMFAVVKAFEAACLKHLKILEDAAGASLKMTTHKEADIEVAELKERYVKVKLVSDEWMKKCDTLVKEWQLLDNTVTELNSWVAADRGAEGEQNFSLEKMESTLGELKNIFKEKEKLVDNL |
⦗Top⦘ |