NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063872_1094854

Scaffold Ga0063872_1094854


Overview

Basic Information
Taxon OID3300021932 Open in IMG/M
Scaffold IDGa0063872_1094854 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 Euk ARK-20-1 (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)600
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)-17.283Long. (o)2.9768Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000293Metagenome / Metatranscriptome1352Y

Sequences

Protein IDFamilyRBSSequence
Ga0063872_10948541F000293N/ACTQCGSSALPNMAVILYSGPRTWGGVYKCFGKRGKKVDMEKTCKIKTVTHFTTDMKKVKTLITGLTWPKGSTLTSLALMRARAELSLGGKDSKSVIVVITDGRPLSYRATGIASRYVRKAARLVWVPVTRYAPLKSIKSWATRRWQENVVVVKQFSDLENPKTVDHVIANICPKH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.