Basic Information | |
---|---|
Taxon OID | 3300021937 Open in IMG/M |
Scaffold ID | Ga0063754_1030211 Open in IMG/M |
Source Dataset Name | Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 Euk ARK-20-2 (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 667 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 78.8697 | Long. (o) | 8.1122 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F071264 | Metagenome / Metatranscriptome | 122 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0063754_10302111 | F071264 | GGA | MRHRGDLGAAVLAEVDCGRVFRVSQSLVRFSSELGLGEVGGTGLSGSLGDLVGDSVHVLDSLSGELLADAGLLAFLRLNVDLLDEFGNGHLLKRVADVLTGSDSDVLFASTVSGTTTVMLSHALGADLSLHVELVHDGGTSGVKPVIIIRGKLLPGGGLGVFGPLGHLDEVLFLEVLSERSDEILGGDILDGRSVLVDEGEVLL |
⦗Top⦘ |