NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063754_1097602

Scaffold Ga0063754_1097602


Overview

Basic Information
Taxon OID3300021937 Open in IMG/M
Scaffold IDGa0063754_1097602 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 Euk ARK-20-2 (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)588
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)78.8697Long. (o)8.1122Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018723Metagenome / Metatranscriptome233Y

Sequences

Protein IDFamilyRBSSequence
Ga0063754_10976021F018723N/AHISLPECSKHSVQMAADKPSADGKQQPTKKGGKEPLIQQFELKDVFPHFCDRKTKLLPLSDVSYVLRAMGWTIYGDEEKTIKEQVEKVDGVGKPVSLQTMQSWVEENDKSYVKSYEDAYNALGTLCHEGIIGDKSNTIKVPFLRHLVTEVGDKMKADTFDKILKGGDIPTNASIKGDSCSLDEFLTFLQK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.