NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213880_10242019

Scaffold Ga0213880_10242019


Overview

Basic Information
Taxon OID3300021953 Open in IMG/M
Scaffold IDGa0213880_10242019 Open in IMG/M
Source Dataset NameBarbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)517
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil

Source Dataset Sampling Location
Location NameBrazil: Minas Gerais
CoordinatesLat. (o)-19.28Long. (o)-43.5919Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088069Metagenome109N

Sequences

Protein IDFamilyRBSSequence
Ga0213880_102420191F088069N/ALRFLSYDLSALQRYRDAVDKEDIEVPGRARNIAGGENAITAVYHSRCSVVEAALDAGLVLTDERDLWIDLETAVQMFGTDSIRCMPTTPTYWMLTLAKSSMVANGHADAALLDSFKSEHQPVRRRGRSLSHIPPGAEPAQPLLEQTA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.