NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213922_1003154

Scaffold Ga0213922_1003154


Overview

Basic Information
Taxon OID3300021956 Open in IMG/M
Scaffold IDGa0213922_1003154 Open in IMG/M
Source Dataset NameFreshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5370
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (90.91%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.9263Long. (o)-83.4268Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001915Metagenome / Metatranscriptome617Y
F006264Metagenome / Metatranscriptome377Y
F031403Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0213922_100315411F031403AGGAMLDKQNVIVENLASSSGNRGLTEQVCHEVYVKMVDYLRLTQSKNTYNRFTDYHYLNIPVSNSTEPIRGIDYIQPIVAPGIDYATAVITKCLMPNGKINFEFERFSEADGDQARQATEMVKYMLNSKNDSYQVIRDWAQDS
Ga0213922_10031542F001915AGGAMEWTLAHPLHDVDDIVEMADSVFGTEVDGILTRDRGVFRKNVTIATTVQLFDKSREFIAVCRDDLNIYGYCWFDRGGYTTYSNEEISNAKFHHVDLTLSPRLRVKLINEMIDQHILWAHTWGIPVVCSTSIRAEHDGFMRIHQKRGFTVNGSYAWIRTEKGMECLKK
Ga0213922_10031549F006264N/AMEDPSKIFQNRLSSQAEACARKTLEWLQKDLQGTHKLEPDEIYYLAYAAQVLLSIRDNYGKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.