NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213922_1007190

Scaffold Ga0213922_1007190


Overview

Basic Information
Taxon OID3300021956 Open in IMG/M
Scaffold IDGa0213922_1007190 Open in IMG/M
Source Dataset NameFreshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3261
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.9263Long. (o)-83.4268Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002433Metagenome / Metatranscriptome559Y
F007799Metagenome344N

Sequences

Protein IDFamilyRBSSequence
Ga0213922_10071905F007799AGGCGGVSFLDNYEDVAARIQRFWATYPNGKIHTSIMDVNLEKGYVLVECRIYRNYEDQEPAGIDYAFGNVNTYNIQMKKWFIEDTCTSAIGRCAGLVLGTDKRPTVQNMRQVEQIDSQIVQDSAKDYDYWSTKFGDVPSFNSQQEADAAGIPTLGTAIDEIKGSLGGVQIAAAPLCAHGHMIWKEGTSAKNGKAWGGYMCVEKVKSKQCPPVWYTLASDGQWKPQI
Ga0213922_10071907F002433N/AVSVGEWTAVGGLVIAVLTAVYSSMRFLVKSIMRELTPNGGNSLKDQVSRIEARLDQLMLEIALKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.