NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213922_1045010

Scaffold Ga0213922_1045010


Overview

Basic Information
Taxon OID3300021956 Open in IMG/M
Scaffold IDGa0213922_1045010 Open in IMG/M
Source Dataset NameFreshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1001
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.9263Long. (o)-83.4268Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001872Metagenome / Metatranscriptome623Y
F010535Metagenome / Metatranscriptome302Y
F044439Metagenome / Metatranscriptome154Y

Sequences

Protein IDFamilyRBSSequence
Ga0213922_10450101F044439GGAGMNYFAEKLLGLMLCTVFGFTALTGAPNASNEPSKTIDVTPFLIEPTTTTSSTIYIDPYSSACEQFSALAVNLGWPADQRTVLEAIIKRESNCTPNAINR
Ga0213922_10450102F010535AGGAMTEPQFFDYSVYTGVMDNGQEILVQIFSSPESGKFLMGQIAFRSAASSWGVPIPLEKR
Ga0213922_10450103F001872N/ARPYTGNSDGASAGPRAGMNEWIKQAIAASNNAVWNNGSWGVRDMRGNPGSLSVHATGRAVDLSYRKSEKHTNASRKSAVSFIDIVVANANTLGVECILDYFPAHGRAWRCDRQAWKKYSKPTIHGAPGGDWFHVEITPQAADSVIFVKAAFLKVFGEIPPKP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.