NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222712_10047423

Scaffold Ga0222712_10047423


Overview

Basic Information
Taxon OID3300021963 Open in IMG/M
Scaffold IDGa0222712_10047423 Open in IMG/M
Source Dataset NameEstuarine water microbial communities from San Francisco Bay, California, United States - C33_657D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3236
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.1516Long. (o)-121.6883Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049633Metagenome / Metatranscriptome146Y
F051131Metagenome / Metatranscriptome144N
F052593Metagenome / Metatranscriptome142Y
F073556Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0222712_100474232F051131AGGAMNRAFIYSYKTFVSFATYEDVTNRDSRVFEANEDLTESEINDYLEQASQRILTQIRNTGWWREYQRKMAQITNPNLLPAVNPDYILARTQEFIDLNVYFALYEYVYPTVADFGNPDSAEFAKIKFYKDSYNVLFDEVIDSGDWYDFSENGTIDTSDKMAAVVNRVRTR
Ga0222712_100474233F049633GAGMRTELLTYLTAQLTDSIRTSQELPFQEGTNPLYMKNPRRVYLDEPYTEEDTLLPTLGSLQINQRVTIVRWFLTVDAKNRNADLDSALTILGSAKDITTITGVYTRLFDYTVSIDNDRVVYEGEYRFANLA
Ga0222712_100474234F052593AGGMAFIFPAPGVENVETTLAIRVSGDTSGLLIPAMQDITINNANDVFTWTQLDEGSKLQIPTTATNSLDLNIVLDQTSFFGTGSGSDVAINKGIFGLSKDKLLVAFTLYLGDTSAGGAGKTMTGNAYITGLAPTVSADSPVWVSPVTLTVTGDYTVTP
Ga0222712_100474235F073556GGAGGMIFDDKTDMEIYLSLEAETAKSLSEIRCARKDLEQAEVRLRFVLTTIHYMKKRYEDYK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.