NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0227318_10084205

Scaffold Ga0227318_10084205


Overview

Basic Information
Taxon OID3300021971 Open in IMG/M
Scaffold IDGa0227318_10084205 Open in IMG/M
Source Dataset NameFood waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed2 spades
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Toronto
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1112
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location
Location NameUniversity of Toronto, Toronto, Ontario, Canada
CoordinatesLat. (o)43.6629Long. (o)-79.3957Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009131Metagenome / Metatranscriptome322Y
F032187Metagenome / Metatranscriptome180Y

Sequences

Protein IDFamilyRBSSequence
Ga0227318_100842052F009131GAGLANHLEISVKELRASQRKCYVKSIECVKKIKSGFASVGAFSSEENFSRGNPEGPMEWISHEAEAFEEILNSRGDICAFSGARGIATVLEKKGCEHVKSLAQSEATLFSEDIKDPSAEASMIGGKFFTDIWDNGGREMAQEIIQKSEKGIHDARKVAEAAEKSTEPEGQIGIN
Ga0227318_100842053F032187N/ALFAVCNSNIAVSSPPSEPAEASPGPHPKGDDEIRKMAEAIMDKVVDQLLNEAAEIVLKED
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.