Scaffold Ga0232646_1232891

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0232646_1232891

Scaffold Ga0232646_1232891

Overview

Basic Information
Taxon OID	3300021978 Open in IMG/M
Scaffold ID	Ga0232646_1232891 Open in IMG/M
Source Dataset Name	Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_CTD_V16A_01_btl17 _150kmer
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1018
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → unclassified Nitrososphaerales → Nitrososphaerales archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc

Source Dataset Sampling Location
Location Name	Perseverance vent field water column
Coordinates	Lat. (^o)	15.47990499	Long. (^o)	144.50763029	Alt. (m)		Depth (m)	3625
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004768	Metagenome / Metatranscriptome	424	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0232646_12328912	F004768	GGAG	MKKATIEILEEGETIFGSRTGGNYMVREYEDGEEMGGSFFKTIEEAEVRVHEYQKIET

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.