NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224902_100196

Scaffold Ga0224902_100196


Overview

Basic Information
Taxon OID3300022066 Open in IMG/M
Scaffold IDGa0224902_100196 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2888
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010091Metagenome / Metatranscriptome308Y
F022423Metagenome / Metatranscriptome214Y
F040134Metagenome / Metatranscriptome162Y

Sequences

Protein IDFamilyRBSSequence
Ga0224902_1001961F010091N/AMITMELEELLEEAENGKRSAIQTRITPEAQPFWEGCEERAKNGRHVKPYVVSRLLKEHFNIKVSESAVRNHFENLAADA
Ga0224902_1001963F040134N/AMDDLIVKSNWKLQSIEYSGLGDKPHFILMNDQGDFKMIPVTKGIHNLRKLLDLERE
Ga0224902_1001965F022423AGAAGMGQDLSFITNTIKTMTESVQNTETLHKIIGTANEYAKTMKFAQDKTYWSDEQLDKYLAMIEKLVDMPVEYTQDDFDKLSLEEKLDAAGLAATDITPGLQGAGDMLGGIVEDVQKQNKYRDDLACPFCKAMVYDNRNSKKSDKSPDFTCSTNDPVVCGGHTGKWRKSWWLDNSDIPKEWNV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.