NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181353_1000479

Scaffold Ga0181353_1000479


Overview

Basic Information
Taxon OID3300022179 Open in IMG/M
Scaffold IDGa0181353_1000479 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)7771
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (27.78%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.2382Long. (o)-86.2805Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000957Metagenome / Metatranscriptome821Y
F003583Metagenome / Metatranscriptome478Y
F024551Metagenome205Y

Sequences

Protein IDFamilyRBSSequence
Ga0181353_100047911F003583N/AMAKVKQSLSGSGNLLLAVTLLTGFAGVSALSSAYIAGYVLDQLQSTDALVMIVTDAGLKSDSADLERNMSTATLALKSVRDIGWALAVGCLGVGAAVFLRSRRQNAS
Ga0181353_10004796F000957N/AMSSFRHLDGMVALLSEIYEINERIMTGDICSAKTAIQSDRMKKLLHHYHEALHEDGAVKVSLQAYAAAGGWVGITYSFELDGFEVAGSQVPRRV
Ga0181353_10004797F024551N/AMTIIRPDSLPRLWWLFPWSIARQLHRNCNALRALADKTDDENRLLRQEVTRLSHSREHWIAKHDRAYAVAMHNERVIARLEDSITRGAITPDAYPHE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.