NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181354_1023208

Scaffold Ga0181354_1023208


Overview

Basic Information
Taxon OID3300022190 Open in IMG/M
Scaffold IDGa0181354_1023208 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1986
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.1881Long. (o)-86.344Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010897Metagenome / Metatranscriptome297Y
F025679Metagenome / Metatranscriptome200Y
F035215Metagenome / Metatranscriptome172N

Sequences

Protein IDFamilyRBSSequence
Ga0181354_10232082F025679AGGMTKTFKIGEYALGGTIRVSIPKTLTTIKIDIIDSNFKTKKLINQYIYYSFDRIRMERDLFQITTSYWSDKILEYVSKTMKQSGEWIGNYRTI
Ga0181354_10232084F035215AGGAGGMKSSEQIAKEISDRISEYKALMVEHSNNQSAVDELESAVHELDHLLRWINE
Ga0181354_10232086F010897N/AMKLINSTSYCSDKLKEIIKWCMPDGVFLKDIRKIDFGNTKLNWHGRAWGSMRVHIGVPRYGKYLRPYNTGGRRGYLNVETYSWEEGLIELIAHELRHLYQYKKNKFFHGIKKIRKYNMGTRAKLCEVDASLYAKRKVREYRKSNFKLNLV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.