NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0196905_1001480

Scaffold Ga0196905_1001480


Overview

Basic Information
Taxon OID3300022198 Open in IMG/M
Scaffold IDGa0196905_1001480 Open in IMG/M
Source Dataset NameFreshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9002
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (82.35%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Chesapeake Bay
CoordinatesLat. (o)38.9819Long. (o)-76.3716Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004762Metagenome / Metatranscriptome424Y
F005088Metagenome / Metatranscriptome412Y
F059776Metagenome / Metatranscriptome133N

Sequences

Protein IDFamilyRBSSequence
Ga0196905_100148011F004762GGAGGMARGNEVLTMLIPTGGWIMSGNDYEGITFLECEPITKAQFEAGFAQYDAWKAEQDSAKATQKAAAEAKLAALGLTADDLKALGL
Ga0196905_100148016F005088GGAVGRGSFGYLIAQIAVETGIAPQYLLELDDVMFKNILKVLTDRAKAVQDANRNKRRY
Ga0196905_10014806F059776AGGMLTDLAVITLTVLIVGLFMLAAYRTGYREGHGDGYLRGRNIAKALKEVTK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.