NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0196905_1008491

Scaffold Ga0196905_1008491


Overview

Basic Information
Taxon OID3300022198 Open in IMG/M
Scaffold IDGa0196905_1008491 Open in IMG/M
Source Dataset NameFreshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3475
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Chesapeake Bay
CoordinatesLat. (o)38.9819Long. (o)-76.3716Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000808Metagenome / Metatranscriptome882Y
F005092Metagenome / Metatranscriptome412Y
F026861Metagenome / Metatranscriptome196Y
F040535Metagenome / Metatranscriptome161Y

Sequences

Protein IDFamilyRBSSequence
Ga0196905_10084911F000808GAGGMEYTYAITTSYDGKLVNTLRVSDMLEAVDAWTKCVDHGNAKEYATYNLSDPTGKMYTKTFYANGAVAIK
Ga0196905_100849112F040535AGGMLTLSYTVEKEGNLITVSDRLMISEYQINNLMDTLVSHGYTVES
Ga0196905_10084913F005092AGGAMDKLEYALRQIENCDLCNGQGVNYWSNGEDYDFEDCVCNPYGIILDEDGDVIWDNGLLSESELSIFATSEAN
Ga0196905_10084918F026861AGGMKLDEFIKLVESEREATRLTNLEKIAKIVENTNTKKGKN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.