NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0196901_1025672

Scaffold Ga0196901_1025672


Overview

Basic Information
Taxon OID3300022200 Open in IMG/M
Scaffold IDGa0196901_1025672 Open in IMG/M
Source Dataset NameFreshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2331
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Chesapeake Bay
CoordinatesLat. (o)38.8455Long. (o)-76.4191Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054888Metagenome / Metatranscriptome139N
F069473Metagenome / Metatranscriptome124N
F087135Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
Ga0196901_10256722F054888AGGAGMDFFEENSGEGNGSNSYLKFLAKEKAWYIGENVYDMEYILLDPDTIQTGLGRYSGGYEFEFSDIPFSKVENKEGWKKAFSVWAFTSDKQVVQWERAAWGELQGFKSMCEKFWMQKAANEGQLPCFRYLGSRGVKFDSGFSSEVPEFEFVAWKPRPAEFVIPAWANDEDVPAPVAESPVEKTVVTDDDIPF
Ga0196901_10256725F087135AGGAGMTQYTDLIKLQALKNDVYEWAEGIKSHYMHTMYGDGYYQIIFNDDSREVMYNDGSVKRTESPHDFEQLVRLYEQDHGEQW
Ga0196901_10256726F069473N/ADMKTELKNKKNKLTERTTTQAIWVDSEIHQLLKEHQVMSRSTRSLGELAAHYIKLGICDARSKDK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.