NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224503_10101492

Scaffold Ga0224503_10101492


Overview

Basic Information
Taxon OID3300022201 Open in IMG/M
Scaffold IDGa0224503_10101492 Open in IMG/M
Source Dataset NameSediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)903
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.79Long. (o)-122.36Alt. (m)Depth (m)17
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005454Metagenome / Metatranscriptome400Y
F022015Metagenome / Metatranscriptome216Y

Sequences

Protein IDFamilyRBSSequence
Ga0224503_101014921F005454N/AMRIIKHFNSHFPERETYKCTIRYTTKFGTLDEVNQWRDDQLKNEDYYKSLEESNTKAAGEFYKTLNYKSD
Ga0224503_101014922F022015N/AMYYQSKSNITWKQAFAEVNASVLRHEIICAIASEVAGKSVENLIGFTDEQRESVWCDYYNTTELCG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.