NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224514_10004612

Scaffold Ga0224514_10004612


Overview

Basic Information
Taxon OID3300022217 Open in IMG/M
Scaffold IDGa0224514_10004612 Open in IMG/M
Source Dataset NameSediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4184
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (20.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → environmental samples → uncultured virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.7Long. (o)-122.34Alt. (m)Depth (m)11
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060807Metagenome / Metatranscriptome132N

Sequences

Protein IDFamilyRBSSequence
Ga0224514_100046126F060807N/AMFGAGNQYKGILGITQKMLAKQEQEQYRANANVGDPFFKPGAERVKPEQRTDSASYGNKSVFSPQQNSYGDYVFGDQGQRQRSMPVRGNVEGPLAMKDQNGDGEITRADVIKARIEGYKE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.