NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224501_10042261

Scaffold Ga0224501_10042261


Overview

Basic Information
Taxon OID3300022223 Open in IMG/M
Scaffold IDGa0224501_10042261 Open in IMG/M
Source Dataset NameSediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3170
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.03Long. (o)-122.15Alt. (m)Depth (m)14
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030416Metagenome / Metatranscriptome185N
F095316Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
Ga0224501_100422614F030416N/AMRYKVSSYKASVEQSVLDTAMAQFCDLAEEMNRPTLDTLIADTVTPEELKRRVPTLVHDSGWKDVEND
Ga0224501_100422615F095316AGGAMENSTTVQTTEGTTISVLVKEGKALASIWKQTNSLKHTIKASGFDTRLGKLLQELKAQSTLDSGQISRQTLTMYGINIIDRRRRSEALWFVENEVDCRKFIEDGKFKGTSLTALQKAMRDAEKAETTEGETSNVGQSDAEQPKADATKPRISHKVMVNTIIAQAELNELDLEEIITDLMAVLEKRQAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.