NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187833_10055141

Scaffold Ga0187833_10055141


Overview

Basic Information
Taxon OID3300022225 Open in IMG/M
Scaffold IDGa0187833_10055141 Open in IMG/M
Source Dataset NameMarine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2732
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location NamePacific Ocean: Eastern Tropical North Pacific
CoordinatesLat. (o)20.3333Long. (o)-107.0Alt. (m)Depth (m)400
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006198Metagenome / Metatranscriptome379Y
F011620Metagenome / Metatranscriptome289Y
F019388Metagenome / Metatranscriptome230N
F029556Metagenome / Metatranscriptome188Y

Sequences

Protein IDFamilyRBSSequence
Ga0187833_100551411F029556GGAGMSMMKFDDSKIEEIRKRKEQGLPPPPDGDVVEQSKNAKGGSELIYQRVKERVPDDLWNYFQVILSRVREYEDKPKILWFQDTSKDPEVQFLKEKSHRDKFE
Ga0187833_100551412F011620GGAMFDKILQAVLKFFGKKTPEPPTDENNESLEALEKVEALDKIGESS
Ga0187833_100551413F019388AGGAMRTEQNPYLVETKNGQILKFSRIDADNEAVSKQLDGDDVEVYHDGKLQYKLHGVEQGKLF
Ga0187833_100551415F006198GGAMEVELDVDCNNCNAKYTMMYEANDIRTRQEEHAFHCAFCGILMEPYYDEFFEED
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.