NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187827_10053334

Scaffold Ga0187827_10053334


Overview

Basic Information
Taxon OID3300022227 Open in IMG/M
Scaffold IDGa0187827_10053334 Open in IMG/M
Source Dataset NameMarine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3233
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location NamePacific Ocean: Eastern Tropical North Pacific
CoordinatesLat. (o)18.2Long. (o)-104.2Alt. (m)Depth (m)150
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006865Metagenome / Metatranscriptome363Y
F010325Metagenome / Metatranscriptome305Y
F029469Metagenome / Metatranscriptome188Y

Sequences

Protein IDFamilyRBSSequence
Ga0187827_100533342F006865GGAGVGKIGQIINVNDTLYEVLGTMSVDRSNDKGTEYWKGQWGADNVLRNGNDYYYCRIIINAEFEDI
Ga0187827_100533343F029469AGGAGMSNKPEHTNYFREIIRRLKEMEIEFGELPKSTEKVYSEMDGKIELMELPFPPEMFNKLSSDERETLFIWLNRRNMPQA
Ga0187827_100533345F010325N/AMLRKELVSDKLDQLQLAVERLKSSIVVPSDQGDVGTPYEVIIQQLQQIENQIDNVINLIELEDD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.