Scaffold Ga0187827_10268995

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0187827_10268995

Scaffold Ga0187827_10268995

Overview

Basic Information
Taxon OID	3300022227 Open in IMG/M
Scaffold ID	Ga0187827_10268995 Open in IMG/M
Source Dataset Name	Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1114
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location Name	Pacific Ocean: Eastern Tropical North Pacific
Coordinates	Lat. (^o)	18.2	Long. (^o)	-104.2	Alt. (m)		Depth (m)	150
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004103	Metagenome	453	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187827_102689955	F004103	N/A	MKLIEKVKPEILKALEKDAKINYSASYKYIIASLKNVDRYRELSINEVDQLITFLPQELHPDSRIDFYYGDYLLKKEYQS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.