NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224507_10156386

Scaffold Ga0224507_10156386


Overview

Basic Information
Taxon OID3300022307 Open in IMG/M
Scaffold IDGa0224507_10156386 Open in IMG/M
Source Dataset NameSediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_13
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)909
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.03Long. (o)-122.37Alt. (m)Depth (m)9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013317Metagenome / Metatranscriptome272Y
F014016Metagenome / Metatranscriptome266N
F014613Metagenome / Metatranscriptome261Y

Sequences

Protein IDFamilyRBSSequence
Ga0224507_101563862F013317N/ALIEKKKWDYLADIRARTGAKTLYINATPQGIYQFDLGALIEPDWVLKSLPVTTDFSNRAHSERLCGFLDIRLAELLLV
Ga0224507_101563863F014016GGAMVNKVALIRFDSQAGAWTDETNWVKGSIIRRFAKERMGKKQLRGRLSKAEISAYWLDKYGVNADVA
Ga0224507_101563864F014613N/AMQMLPNLSDEAVVGIIIGVPFIGLYIWSLWNSAKAKAFNQGYKRGRESVRYTEI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.