NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0242648_1012010

Scaffold Ga0242648_1012010


Overview

Basic Information
Taxon OID3300022506 Open in IMG/M
Scaffold IDGa0242648_1012010 Open in IMG/M
Source Dataset NameMetatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)997
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006948Metagenome / Metatranscriptome361Y

Sequences

Protein IDFamilyRBSSequence
Ga0242648_10120101F006948GGAGGVRVKSVPVAFAILFVGVVSAPGASAQNPDTMMPEQSVAKGKQLLSDLINALGGPGYTEVRESHCQGRRSQFGHNGEPLHPVLIDFSEYRRYPDKVRTEYISKGRNTILASLIGVDGLDFTHGGIVISLYNGDHGWTFDRSGVSELPAGAISDFQEQVKRNVDNLLRLRLKEEGISIRFGGSDTVDLKPVDWIEITDSQERKFRLAVDRSTHLLVRSVVITKDEETQQINEDVSIYSNYQLKDSVWMPIQISREHNGRRAAQIFYDSCKFNPGFSDDIFDKSSLSEQGSQALVKKSKN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.