NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0242660_1012412

Scaffold Ga0242660_1012412


Overview

Basic Information
Taxon OID3300022531 Open in IMG/M
Scaffold IDGa0242660_1012412 Open in IMG/M
Source Dataset NameMetatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1483
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008565Metagenome / Metatranscriptome331Y
F035384Metagenome / Metatranscriptome172Y

Sequences

Protein IDFamilyRBSSequence
Ga0242660_10124122F008565AGGAGMKRVTIVATLLLLCISFPIHSTAARHKVPRYLNKESTVDMSNMNRIFVGWVDLGADDWALYGYENKTDWADIIGSLNSSFSRNLVPGRTIASAKDKGDENAVGNDLYIKFSDVRVDYNNYHLILSIHFIDLKTNSEIATIPVRPYYGNDWGLKNYLKAALDEVATKVQVEVTGETPQKKQ
Ga0242660_10124123F035384N/AFSWLLPAGIVLFFVVTLSAGDLETKGKAWLGSHSEAAAINVNGHWHEKSWGTVVLNQAEGSRDVTGDGDGWDITGVVSGKQVFLLFSYHDRVNYSAQLTSEADSSLNGTYLKGLMNEKSKGRPMHLTKQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.