NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212119_1035399

Scaffold Ga0212119_1035399


Overview

Basic Information
Taxon OID3300022543 Open in IMG/M
Scaffold IDGa0212119_1035399 Open in IMG/M
Source Dataset NameIndian_combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)800
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameUSA: Indian Creek, Illinois
CoordinatesLat. (o)41.6655Long. (o)-87.5437Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028780Metagenome / Metatranscriptome190N
F040591Metagenome / Metatranscriptome161Y

Sequences

Protein IDFamilyRBSSequence
Ga0212119_10353991F028780N/AISSHYEELYRYTRYFCSKYNPKLTIDTVISNAYLHCIEINDNTEDVGKVKSYILNSIKRQVIWKNVDSYKDERILASEIAVPDTFDDGEDLNYKIAIEQQYQGWKSSVDIYRDGLTDNVKIAVAKAYFDKNFTTARSMAEYFNIPVTSAHYLIADIKTTLKIIHNEDKK
Ga0212119_10353992F040591N/AMKIKSEYKGMTLMKNTALGNITVVVDNIDMNKYDYYVSIGFAYLFEKETATAPIRYEGIEADEQTEAPKVIKPKRKRRTNAKTDTI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.