NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212122_1034752

Scaffold Ga0212122_1034752


Overview

Basic Information
Taxon OID3300022546 Open in IMG/M
Scaffold IDGa0212122_1034752 Open in IMG/M
Source Dataset NameLHC4_combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1284
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameUSA: California, Little Hot Creek
CoordinatesLat. (o)37.6906Long. (o)-118.8442Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079345Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0212122_10347521F079345GGAGGMLSVALGLELEGLSTLQRKLLVELLQKRYPHYWSRFVSPRHGWQSQKEALEEFLQNHGTELVREFAKAGLHGNGRKTARRSGVHVQG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.