Basic Information | |
---|---|
Taxon OID | 3300022546 Open in IMG/M |
Scaffold ID | Ga0212122_1055754 Open in IMG/M |
Source Dataset Name | LHC4_combined assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 868 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California, Little Hot Creek | |||||||
Coordinates | Lat. (o) | 37.6906 | Long. (o) | -118.8442 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006925 | Metagenome | 362 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0212122_10557541 | F006925 | N/A | REAELRKKWMRMWERLGVRILNMPKWMQEIVLEDINTAIRNRIAIMEMIQNAKRNR |
⦗Top⦘ |