Scaffold Ga0212118_10104209

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0212118_10104209

Scaffold Ga0212118_10104209

Overview

Basic Information
Taxon OID	3300022552 Open in IMG/M
Scaffold ID	Ga0212118_10104209 Open in IMG/M
Source Dataset Name	Guaymas_combined assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1668
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	Mexico: Guaymas Basin, Gulf of California
Coordinates	Lat. (^o)	27.0078	Long. (^o)	-111.4071	Alt. (m)		Depth (m)	2000
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096384	Metagenome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212118_101042092	F096384	AGGA	MMVFKDFARIGVPLEIGGRADESVPFVERASLNAPLQWKLGRSKIQVFSSS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.