Basic Information | |
---|---|
Taxon OID | 3300022554 Open in IMG/M |
Scaffold ID | Ga0212093_1104476 Open in IMG/M |
Source Dataset Name | Dewar_combined assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1304 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → Archaeoglobi → Archaeoglobales → unclassified Archaeoglobales → Archaeoglobales archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: British Columbia | |||||||
Coordinates | Lat. (o) | 49.9543 | Long. (o) | -116.5155 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F103293 | Metagenome | 101 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0212093_11044762 | F103293 | AGG | MALALDAVPWLEPPFEIFEFKPCEWAAFHVTAYKIGKMNIAPRWPGAPSAKAILAIRLFVDPKTKPAYPHYWDITPSRLVSQLAAMLTRGIPPGAYLRVHRDVAGPKAHFSVEWAPTV |
⦗Top⦘ |