NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212088_10001848

Scaffold Ga0212088_10001848


Overview

Basic Information
Taxon OID3300022555 Open in IMG/M
Scaffold IDGa0212088_10001848 Open in IMG/M
Source Dataset NameAlinen_combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)45791
Total Scaffold Genes34 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (58.82%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameFinland: Lake Alinen Mustajarvi
CoordinatesLat. (o)61.5637Long. (o)22.044Alt. (m)Depth (m)4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034231Metagenome / Metatranscriptome175Y
F053934Metagenome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0212088_1000184826F034231GGAMPLIKLNRINKGGEILINSEHILLVEVESRTTTVHLIDRSLFSVEESPALIGDKIEAAHTARIANAIQQSGLTGKPS
Ga0212088_100018487F053934GGAMNTELEAYFAAARTASSSPPKDSEARIQERADFPIRFLETADSLLKSVLDSTAETLQTHGHGASVELVRDQSGSDPNSYPYITLHFSPERCPSSDLSYIYTLAGASISFICRRNDLSIEVVIAHPAGRGVERRVNFATFTLANLNPQRVARIVTDAVKQIIRL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.