Scaffold Ga0212121_10042292

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0212121_10042292

Scaffold Ga0212121_10042292

Overview

Basic Information
Taxon OID	3300022556 Open in IMG/M
Scaffold ID	Ga0212121_10042292 Open in IMG/M
Source Dataset Name	Kivu_combined assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3874
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	Rwanda: Lake Kivu
Coordinates	Lat. (^o)	-2.0288	Long. (^o)	29.1756	Alt. (m)		Depth (m)	325
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026777	Metagenome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212121_100422923	F026777	GAGG	MSKRNALTEQSIIIDDVLSMLTGHPRGSLVSFTEMTKSLHDYIKMNGLRQRFCPHCNAPLTGSASASQPVVTEVPAT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.