NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212123_10001014

Scaffold Ga0212123_10001014


Overview

Basic Information
Taxon OID3300022557 Open in IMG/M
Scaffold IDGa0212123_10001014 Open in IMG/M
Source Dataset NamePaint Pots_combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)82459
Total Scaffold Genes73 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)50 (68.49%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameCanada: Banff, British Columbia
CoordinatesLat. (o)51.1699Long. (o)-116.1578Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000634Metagenome / Metatranscriptome971Y
F001718Metagenome / Metatranscriptome647Y
F008141Metagenome / Metatranscriptome338Y

Sequences

Protein IDFamilyRBSSequence
Ga0212123_1000101453F008141AGGMVIGPAVRLVRQVQIAMLVSIALYAAAGEMLAGKLAHDPANALFHALSFISISIVGATVVIRRTLVLPSEGLLKEKSDDSVAVARWRTGYLFLFALCELLGVFGLILRMSGFTLGNVWGFYLGGFVLLLLYSPRAPRAEFG
Ga0212123_1000101460F001718AGGMTTAWGRILPETKSDGDGFYYLLAMMLGALAGWVNIKVGDLLLTAMVVLAACMLLGILSPRKPWRWVLLVGVFVPVVEWLAYFFLSQKPERAQIYESFLAFLPGIAGAFGGAMGRGLVDNLFSGK
Ga0212123_1000101472F000634AGGAGGVPATAHQSTIKILYGESDEHTLSAQAAEIAKAGHHITTALNRHGVQEALSRDAFDLVILGATLSKEDRHHLPYMVKKAHEGTKVLVMHAGSHHHAVDAAIDSNLSMHRILERIATLLQPAPVR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.